Loading...
Statistics
Advertisement

Home - ATER Viterbo
www.atervt.it/
Azienda Territoriale per l’Edilizia Residenziale Pubblica della Provincia di Viterbo

Atervt.it

Advertisement
Conversion Technology Metas Server
Atervt.it is hosted in Italy / Arezzo . Atervt.it doesn't use HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Html, Iframe, Number of used javascripts: 7. First javascripts: Mootools-core.js, Core.js, Modal.js, Number of used analytics tools: 0. Number of used plugins, modules: 1. Its server type is: Apache. Its CMS is: Joomla.

Technologies in use by Atervt.it

Technology

Number of occurences: 6
  • CSS
  • Html
  • Iframe
  • Javascript
  • jQuery
  • Php

Advertisement

Javascripts

Number of occurences: 7
  • mootools-core.js
  • core.js
  • modal.js
  • jquery.min.js
  • k2.noconflict.js
  • k2.js
  • mootools-more.js

Content Management System

Number of occurences: 1
  • Joomla

Server Type

  • Apache

Powered by

  • PHP/5.3.29

Used plugins, modules

Number of plugins and modules: 1
  • k2

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Atervt.it

Missing HTTPS protocol.

    Meta - Atervt.it

    Number of occurences: 4
    • Name:
      Content: Azienda Territoriale per l’Edilizia Residenziale Pubblica della Provincia di Viterbo
    • Name: keywords
      Content: Edilizia residenziale, Provincia di Viterbo, bandi, gare, appalti, concorsi
    • Name: description
      Content: Azienda Territoriale per l’Edilizia Residenziale Pubblica della Provincia di Viterbo
    • Name: generator
      Content: Joomla! - Open Source Content Management

    Server / Hosting

    • IP: 62.149.142.90
    • Latitude: 43.42
    • Longitude: 11.88
    • Country: Italy
    • City: Arezzo

    Rname

    • dns3.arubadns.net
    • dns2.technorail.com
    • dns.technorail.com
    • dns4.arubadns.cz
    • mx.atervt.it

    Target

    • hostmaster.atervt.it

    HTTP Header Response

    HTTP/1.1 200 OK Date: Fri, 07 Oct 2016 11:08:32 GMT Server: Apache X-Powered-By: PHP/5.3.29 X-Logged-In: False Cache-Control: no-cache Pragma: no-cache Set-Cookie: 07a9bc6bcb91c86225d0b5bd69801553=quk872or2nni9j0c1461ff8l26; path=/ Content-Type: text/html; charset=utf-8 X-Cache: MISS from s_hv1027 Transfer-Encoding: chunked Via: 1.1 s_hv1027 (squid/3.5.20) Connection: keep-alive

    DNS

    host: atervt.it
    1. class: IN
    2. ttl: 86400
    3. type: A
    4. ip: 62.149.128.160
    host: atervt.it
    1. class: IN
    2. ttl: 86400
    3. type: A
    4. ip: 62.149.128.154
    host: atervt.it
    1. class: IN
    2. ttl: 86400
    3. type: A
    4. ip: 62.149.128.157
    host: atervt.it
    1. class: IN
    2. ttl: 86400
    3. type: A
    4. ip: 62.149.128.151
    host: atervt.it
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: dns3.arubadns.net
    host: atervt.it
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: dns2.technorail.com
    host: atervt.it
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: dns.technorail.com
    host: atervt.it
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: dns4.arubadns.cz
    host: atervt.it
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: dns.technorail.com
    5. rname: hostmaster.atervt.it
    6. serial: 1
    7. refresh: 86400
    8. retry: 7200
    9. expire: 2592000
    10. minimum-ttl: 3600
    host: atervt.it
    1. class: IN
    2. ttl: 86400
    3. type: MX
    4. pri: 10
    5. target: mx.atervt.it

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.tervt.it, www.aotervt.it, www.otervt.it, www.aptervt.it, www.ptervt.it, www.a9tervt.it, www.9tervt.it, www.atervt.it, www.tervt.it, www.aitervt.it, www.itervt.it, www.autervt.it, www.utervt.it, www.aervt.it, www.atqervt.it, www.aqervt.it, www.ataervt.it, www.aaervt.it, www.at ervt.it, www.a ervt.it, www.atwervt.it, www.awervt.it, www.ateervt.it, www.aeervt.it, www.atzervt.it, www.azervt.it, www.atxervt.it, www.axervt.it, www.atcervt.it, www.acervt.it, www.atrvt.it, www.atexrvt.it, www.atxrvt.it, www.atesrvt.it, www.atsrvt.it, www.atewrvt.it, www.atwrvt.it, www.aterrvt.it, www.atrrvt.it, www.atefrvt.it, www.atfrvt.it, www.atevrvt.it, www.atvrvt.it, www.atecrvt.it, www.atcrvt.it, www.ateqrvt.it, www.atqrvt.it, www.atearvt.it, www.atarvt.it, www.ateyrvt.it, www.atyrvt.it, www.atevt.it, www.aterivt.it, www.ateivt.it, www.aterovt.it, www.ateovt.it, www.aterlvt.it, www.atelvt.it, www.aterlvt.it, www.atelvt.it, www.ater.vt.it, www.ate.vt.it, www.atert.it, www.atervyt.it, www.ateryt.it, www.atervzt.it, www.aterzt.it, www.atervht.it, www.aterht.it, www.atervnt.it, www.aternt.it, www.atervmt.it, www.atermt.it, www.atervjt.it, www.aterjt.it, www.atervkt.it, www.aterkt.it, www.atervit.it, www.aterit.it, www.aterv.it, www.atervtq.it, www.atervq.it, www.atervta.it, www.aterva.it, www.atervt .it, www.aterv .it, www.atervtw.it, www.atervw.it, www.atervte.it, www.aterve.it, www.atervtz.it, www.atervz.it, www.atervtx.it, www.atervx.it, www.atervtc.it, www.atervc.it,

    Other websites we recently analyzed

    1. tuckerbicycle
      Check out this GoDaddy hosted webpage! http://tuckerbicycle.com.
      Scottsdale (United States) - 97.74.42.79
      Server software: Microsoft-IIS/7.0
      Technology: CSS, Html, Javascript, jQuery, jQuery UI
      Number of Javascript: 4
      Number of meta tags: 3
    2. Lehigh Cottage
      Scottsdale (United States) - 97.74.141.128
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery
      Number of Javascript: 4
      Number of meta tags: 4
    3. MK MEDIA - Интернет-маркетинг
      MK MEDIA - Интернет-маркетинг
      Russian Federation - 77.222.56.94
      Server software: nginx/1.9.12
      Technology: CSS, Html, Html5, Javascript, LiveInternet counter
      Number of Javascript: 1
      Number of meta tags: 4
    4. Welcome to COLORADOSPRINGSCRIMINALDEFENSELAWYER.COM
      Scottsdale (United States) - 184.168.221.96
      Server software: Microsoft-IIS/7.5
      Technology: Google Adsense, CSS, Html, Javascript
      Number of Javascript: 3
      Number of meta tags: 2
    5. Home
      Brea (United States) - 69.163.144.16
      Server software: Apache
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 6
      Number of meta tags: 2
    6. Trakehner France - Association Française du Trakehner
      Trakehner France - Site officiel de AFT - Association Française du Trakehner - Histoire - Chevaux - Elevages - Trakehner Frankreich
      United States - 159.100.190.4
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 7
      Number of meta tags: 10
    7. jesusair.org
      Scottsdale (United States) - 50.63.202.55
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    8. Eye 2 Eye Support group for the blind, legally blind, and Deaf in Yale Michigan
      Eye 2 Eye Support group for the blind, legally blind, and Deaf in Yale Michigan
      Houston (United States) - 192.185.185.70
      Server software: nginx/1.10.1
      Technology: CSS, Html, Javascript
      Number of meta tags: 3
    9. nuohang.faith
      Austin (United States) - 209.99.40.221
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    10. Larry's Towing | Champion Collision | Oconto Falls, WI
      Champion Collision and Larry’s Towing located in Oconto Falls, WI offers 27/7 Tow Service, Roadside Assistance and Collision Repair.
      Green Bay (United States) - 66.180.167.46
      G Analytics ID: UA-68261129-2
      Server software: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
      Technology: CSS, Google Font API, Html, Javascript, Google Analytics
      Number of Javascript: 4
      Number of meta tags: 3

    Check Other Websites